Lineage for d1u9lb_ (1u9l B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917037Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 917059Family a.60.4.2: NusA extra C-terminal domains [109873] (1 protein)
  6. 917060Protein Transcription elongation protein NusA [109874] (1 species)
  7. 917061Species Escherichia coli [TaxId:562] [109875] (2 PDB entries)
    Uniprot P03003 352-419
  8. 917063Domain d1u9lb_: 1u9l B: [107752]
    complexed with au

Details for d1u9lb_

PDB Entry: 1u9l (more details), 1.9 Å

PDB Description: Structural basis for a NusA- protein N interaction
PDB Compounds: (B:) Transcription elongation protein nusA

SCOPe Domain Sequences for d1u9lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9lb_ a.60.4.2 (B:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaqaq

SCOPe Domain Coordinates for d1u9lb_:

Click to download the PDB-style file with coordinates for d1u9lb_.
(The format of our PDB-style files is described here.)

Timeline for d1u9lb_: