| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.4.2: NusA extra C-terminal domains [109873] (1 protein) |
| Protein Transcription elongation protein NusA [109874] (1 species) |
| Species Escherichia coli [TaxId:562] [109875] (2 PDB entries) Uniprot P03003 352-419 |
| Domain d1u9la_: 1u9l A: [107751] complexed with au |
PDB Entry: 1u9l (more details), 1.9 Å
SCOPe Domain Sequences for d1u9la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaq
Timeline for d1u9la_: