Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins) Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping) |
Protein Hypothetical protein PA1358 [110884] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [110885] (1 PDB entry) Uniprot Q9I3Y6 |
Domain d1u7ib1: 1u7i B:1-132 [107725] Other proteins in same PDB: d1u7ia2, d1u7ia3, d1u7ib2 Structural genomics target |
PDB Entry: 1u7i (more details), 1.4 Å
SCOPe Domain Sequences for d1u7ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7ib1 d.32.1.7 (B:1-132) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} msarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdqs vhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawla drfgvswqlnla
Timeline for d1u7ib1: