SCOPe 2.08: Domain d1u7ib1: 1u7i B:1-132

Lineage for d1u7ib1 (1u7i B:1-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
   Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)

6. Protein Hypothetical protein PA1358 [110884] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110885] (1 PDB entry)
   Uniprot Q9I3Y6

8. Domain d1u7ib1: 1u7i B:1-132 [107725]
   Other proteins in same PDB: d1u7ia2, d1u7ia3, d1u7ib2
   Structural genomics target

Details for d1u7ib1

PDB Entry: 1u7i, 1.4 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA1358 from Pseudomonas aeruginosa

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1u7ib1:

Sequence; same for both SEQRES and ATOM records:

>d1u7ib1 d.32.1.7 (B:1-132) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]}
msarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdqs
vhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawla
drfgvswqlnla

Timeline for d1u7ib1:

• d1u7ib1 first appeared in SCOP 1.69, called d1u7ib_
  
• d1u7ib1 appears in SCOPe 2.07