Lineage for d1u7ia1 (1u7i A:1-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942843Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase [110883] (4 proteins)
    Pfam PF06983; both variants of dimeric assembly are observed in the family (domain swapping)
  6. 2942851Protein Hypothetical protein PA1358 [110884] (1 species)
  7. 2942852Species Pseudomonas aeruginosa [TaxId:287] [110885] (1 PDB entry)
    Uniprot Q9I3Y6
  8. 2942853Domain d1u7ia1: 1u7i A:1-132 [107724]
    Other proteins in same PDB: d1u7ia2, d1u7ia3, d1u7ib2
    Structural genomics target

Details for d1u7ia1

PDB Entry: 1u7i (more details), 1.4 Å

PDB Description: Crystal Structure of Protein of Unknown Function PA1358 from Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1u7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7ia1 d.32.1.7 (A:1-132) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]}
msarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdqs
vhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawla
drfgvswqlnla

SCOPe Domain Coordinates for d1u7ia1:

Click to download the PDB-style file with coordinates for d1u7ia1.
(The format of our PDB-style files is described here.)

Timeline for d1u7ia1: