PDB entry 1u7i

View 1u7i on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function PA1358 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, PA1358, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2004-08-03, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.148
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1358
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3Y6 (2-133)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (11)
      • modified residue (21)
      • modified residue (106)
      • cloning artifact (134)
    Domains in SCOPe 2.07: d1u7ia1, d1u7ia2, d1u7ia3
  • Chain 'B':
    Compound: hypothetical protein
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1358
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3Y6 (2-133)
      • modified residue (2)
      • modified residue (11)
      • modified residue (21)
      • modified residue (106)
      • cloning artifact (134)
    Domains in SCOPe 2.07: d1u7ib1, d1u7ib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u7iA (A:)
    ghmsarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgd
    qsvhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfaw
    ladrfgvswqlnlags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7iA (A:)
    hmsarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdq
    svhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawl
    adrfgvswqlnlag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7iB (B:)
    ghmsarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgd
    qsvhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfaw
    ladrfgvswqlnlags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7iB (B:)
    msarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdqs
    vhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawla
    drfgvswqlnlag