SCOPe 2.02: Domain d1u61a_: 1u61 A:

Lineage for d1u61a_ (1u61 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (2 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein Hypothetical protein BC0111 [109892] (1 species)

7. Species Bacillus cereus [TaxId:1396] [109893] (1 PDB entry)
   Uniprot Q81J58

8. Domain d1u61a_: 1u61 A: [107696]
   Structural genomics target

Details for d1u61a_

PDB Entry: 1u61, 2.15 Å

PDB Description: Crystal Structure of Putative Ribonuclease III from Bacillus cereus

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1u61a_:

Sequence; same for both SEQRES and ATOM records:

>d1u61a_ a.149.1.1 (A:) Hypothetical protein BC0111 {Bacillus cereus [TaxId: 1396]}
idakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvyhlle
taflteeeeavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerldeivyk
aiavlee

Timeline for d1u61a_:

• d1u61a_ first appeared in SCOP 1.69
  
• d1u61a_ appears in SCOPe 2.01
  
• d1u61a_ appears in SCOPe 2.03
  
• d1u61a_ appears in the current release, SCOPe 2.08