Class a: All alpha proteins [46456] (218 folds) |
Fold a.149: RNase III catalytic domain-like (Pfam 00636) [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III catalytic domain-like (Pfam 00636) [69065] (1 family) |
Family a.149.1.1: RNase III catalytic domain-like (Pfam 00636) [69066] (2 proteins) |
Protein Hypothetical protein BC0111 [109892] (1 species) |
Species Bacillus cereus [TaxId:1396] [109893] (1 PDB entry) |
Domain d1u61a_: 1u61 A: [107696] Structural genomics target |
PDB Entry: 1u61 (more details), 2.15 Å
SCOP Domain Sequences for d1u61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u61a_ a.149.1.1 (A:) Hypothetical protein BC0111 {Bacillus cereus} idakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvyhlle taflteeeeavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerldeivyk aiavlee
Timeline for d1u61a_: