Lineage for d1u61a_ (1u61 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449785Fold a.149: RNase III catalytic domain-like (Pfam 00636) [69064] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 449786Superfamily a.149.1: RNase III catalytic domain-like (Pfam 00636) [69065] (1 family) (S)
  5. 449787Family a.149.1.1: RNase III catalytic domain-like (Pfam 00636) [69066] (2 proteins)
  6. 449788Protein Hypothetical protein BC0111 [109892] (1 species)
  7. 449789Species Bacillus cereus [TaxId:1396] [109893] (1 PDB entry)
  8. 449790Domain d1u61a_: 1u61 A: [107696]
    Structural genomics target

Details for d1u61a_

PDB Entry: 1u61 (more details), 2.15 Å

PDB Description: Crystal Structure of Putative Ribonuclease III from Bacillus cereus

SCOP Domain Sequences for d1u61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u61a_ a.149.1.1 (A:) Hypothetical protein BC0111 {Bacillus cereus}
idakqlnslalaymgdavyeqyiryhllqkgkvrpnqlhrlgtsfvsakaqakvvyhlle
taflteeeeavlrrgrnansgtvpkntdvqtyrhstafealigyhhllnnrerldeivyk
aiavlee

SCOP Domain Coordinates for d1u61a_:

Click to download the PDB-style file with coordinates for d1u61a_.
(The format of our PDB-style files is described here.)

Timeline for d1u61a_: