![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins) duplication: tandem repeat of two "winged-helix" domains |
![]() | Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries) Uniprot P47142 |
![]() | Domain d1u5tc2: 1u5t C:126-199 [107689] Other proteins in same PDB: d1u5ta1, d1u5ta2, d1u5tb1, d1u5tb2 |
PDB Entry: 1u5t (more details), 3.6 Å
SCOPe Domain Sequences for d1u5tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u5tc2 a.4.5.54 (C:126-199) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr atmlkdendkviai
Timeline for d1u5tc2: