SCOPe 2.06: Domain d1u5tc2: 1u5t C:126-199

Lineage for d1u5tc2 (1u5t C:126-199)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
   duplication: tandem repeat of two "winged-helix" domains

6. Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (3 PDB entries)
   Uniprot P47142

8. Domain d1u5tc2: 1u5t C:126-199 [107689]
   Other proteins in same PDB: d1u5ta1, d1u5ta2, d1u5tb1, d1u5tb2

Details for d1u5tc2

PDB Entry: 1u5t, 3.6 Å

PDB Description: Structure of the ESCRT-II endosomal trafficking complex

PDB Compounds: (C:) Hypothetical 23.6 kDa protein in YUH1-URA8 intergenic region

SCOPe Domain Sequences for d1u5tc2:

Sequence; same for both SEQRES and ATOM records:

>d1u5tc2 a.4.5.54 (C:126-199) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr
atmlkdendkviai

Timeline for d1u5tc2:

• d1u5tc2 first appeared in SCOP 1.69
  
• d1u5tc2 appears in SCOPe 2.05
  
• d1u5tc2 appears in SCOPe 2.07
  
• d1u5tc2 appears in the current release, SCOPe 2.08