Lineage for d1u5tc2 (1u5t C:126-199)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439155Family a.4.5.54: Vacuolar sorting protein domain [109692] (3 proteins)
    duplication: tandem repeat of two "winged-helix" domains
  6. 439156Protein Vacuolar protein sorting-associated protein VPS25 [109697] (1 species)
  7. 439157Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109698] (1 PDB entry)
  8. 439159Domain d1u5tc2: 1u5t C:126-199 [107689]
    Other proteins in same PDB: d1u5ta1, d1u5ta2, d1u5tb1, d1u5tb2

Details for d1u5tc2

PDB Entry: 1u5t (more details), 3.6 Å

PDB Description: Structure of the ESCRT-II endosomal trafficking complex

SCOP Domain Sequences for d1u5tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u5tc2 a.4.5.54 (C:126-199) Vacuolar protein sorting-associated protein VPS25 {Baker's yeast (Saccharomyces cerevisiae)}
ksldswaslilqwfedsgklnqvitlyelsegdetvnwefhrmpesllyyclkplcdrnr
atmlkdendkviai

SCOP Domain Coordinates for d1u5tc2:

Click to download the PDB-style file with coordinates for d1u5tc2.
(The format of our PDB-style files is described here.)

Timeline for d1u5tc2: