SCOPe 2.02: Domain d1u3ca1: 1u3c A:198-497

Lineage for d1u3ca1 (1u3c A:198-497)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family)

5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)

6. Protein Cryptochrome C-terminal domain [81841] (2 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109947] (2 PDB entries)
   Uniprot Q43125 13-497

8. Domain d1u3ca1: 1u3c A:198-497 [107636]
   Other proteins in same PDB: d1u3ca2
   complexed with cl, fad, hez, mg, nds

Details for d1u3ca1

PDB Entry: 1u3c, 2.6 Å

PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana

PDB Compounds: (A:) Cryptochrome 1 apoprotein

SCOPe Domain Sequences for d1u3ca1:

Sequence; same for both SEQRES and ATOM records:

>d1u3ca1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eddsekgsnallarawspgwsngdkalttfingplleysknrrkadsattsflsphlhfg
evsvrkvfhlvrikqvawanegneageesvnlflksiglreysryisfnhpysherpllg
hlkffpwavdenyfkawrqgrtgyplvdagmrelwatgwlhdrirvvvssffvkvlqlpw
rwgmkyfwdtlldadlesdalgwqyitgtlpdsrefdridnpqfegykfdpngeyvrrwl
pelsrlptdwihhpwnapesvlqaagielgsnyplpivgldeakarlhealsqmwqleaa

Timeline for d1u3ca1:

• d1u3ca1 first appeared in SCOP 1.69
  
• d1u3ca1 appears in SCOPe 2.01
  
• d1u3ca1 appears in SCOPe 2.03
  
• d1u3ca1 appears in the current release, SCOPe 2.08