SCOPe 2.02: Domain d1u34a_: 1u34 A:

Lineage for d1u34a_ (1u34 A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.76: Hormone receptor domain [111417] (1 superfamily)
   disulfide-rich all-beta fold; contains beta sandwich of 5 strands

4. Superfamily g.76.1: Hormone receptor domain [111418] (1 family)

5. Family g.76.1.1: Hormone receptor domain [111419] (2 proteins)
   Pfam PF02793; HRM

6. Protein Corticotropin releasing factor receptor 2, CRFR-2beta [111420] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111421] (1 PDB entry)
   Uniprot Q60748 39-133

8. Domain d1u34a_: 1u34 A: [107634]

Details for d1u34a_

PDB Entry: 1u34

PDB Description: 3d nmr structure of the first extracellular domain of crfr-2beta, a type b1 g-protein coupled receptor

PDB Compounds: (A:) Corticotropin releasing factor receptor 2

SCOPe Domain Sequences for d1u34a_:

Sequence; same for both SEQRES and ATOM records:

>d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]}
gsgmketaaakferqhmdspdlgttlleqychrttignfsgpytycnttldqigtcwpqs
apgalverpcpeyfngikynttrnayreclengtwasrvnyshcepilddkqrkydlhy

Timeline for d1u34a_:

• d1u34a_ first appeared in SCOP 1.69
  
• d1u34a_ appears in SCOPe 2.01
  
• d1u34a_ appears in SCOPe 2.03
  
• d1u34a_ appears in the current release, SCOPe 2.08, called d1u34a1