| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (5 species) |
| Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries) |
| Domain d1tzye_: 1tzy E: [107534] Other proteins in same PDB: d1tzyb_, d1tzyc_, d1tzyd_, d1tzyf_, d1tzyg_, d1tzyh_ complexed with cl, po4 |
PDB Entry: 1tzy (more details), 1.9 Å
SCOP Domain Sequences for d1tzye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tzye_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
aksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllp
Timeline for d1tzye_: