Lineage for d1tzyd_ (1tzy D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909520Protein Histone H4 [47125] (5 species)
  7. 909589Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (5 PDB entries)
    Uniprot P62801
  8. 909590Domain d1tzyd_: 1tzy D: [107533]
    Other proteins in same PDB: d1tzya_, d1tzyb_, d1tzyc_, d1tzye_, d1tzyf_, d1tzyg_
    complexed with cl, po4

Details for d1tzyd_

PDB Entry: 1tzy (more details), 1.9 Å

PDB Description: Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
PDB Compounds: (D:) histone h4-vi

SCOPe Domain Sequences for d1tzyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzyd_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1tzyd_:

Click to download the PDB-style file with coordinates for d1tzyd_.
(The format of our PDB-style files is described here.)

Timeline for d1tzyd_: