SCOPe 2.08: Domain d1tzhh1: 1tzh H:1-113

Lineage for d1tzhh1 (1tzh H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1tzhh1: 1tzh H:1-113 [107481]
   Other proteins in same PDB: d1tzha1, d1tzha2, d1tzhb2, d1tzhh2, d1tzhl1, d1tzhl2, d1tzhv_, d1tzhw_

Details for d1tzhh1

PDB Entry: 1tzh, 2.6 Å

PDB Description: Crystal Structure of the Fab YADS1 Complexed with h-VEGF

PDB Compounds: (H:) Fab YADS1 Heavy Chain

SCOPe Domain Sequences for d1tzhh1:

Sequence; same for both SEQRES and ATOM records:

>d1tzhh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfdiydddihwvrqapgkglewvayiapsygytdy
adsvkgrftisadtskntaylqmnslraedtavyycsrssdasysysamdywgqgtlvtv
ss

Timeline for d1tzhh1:

• d1tzhh1 first appeared in SCOP 1.69
  
• d1tzhh1 appears in SCOPe 2.07