Lineage for d1tzdb_ (1tzd B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542070Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2542071Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2542110Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
    Pfam PF03770
  6. 2542111Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)
  7. 2542119Species Norway rat (Rattus norvegicus) [TaxId:10116] [111191] (1 PDB entry)
    Uniprot P17105 203-458
  8. 2542121Domain d1tzdb_: 1tzd B: [107475]
    complexed with adp, mg

Details for d1tzdb_

PDB Entry: 1tzd (more details), 2.2 Å

PDB Description: crystal structure of the catalytic core of inositol 1,4,5-trisphosphate 3-kinase
PDB Compounds: (B:) inositol-trisphosphate 3-kinase a

SCOPe Domain Sequences for d1tzdb_:

Sequence, based on SEQRES records: (download)

>d1tzdb_ d.143.1.3 (B:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
glilkrssepehycmvrlmadvlrgcvpafhgvverdgesylqlqdlldgfdgpcvldck
mgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprymqwregiss
sttlgfriegikkadgscstdfkttrsreqvtrvfeefmqgdaevlkrylnrlqqirdtl
eisdffrrhevigssllfvhdhchragvwlidfgkttplpngqildhrrpweegnredgy
llgldnligilanla

Sequence, based on observed residues (ATOM records): (download)

>d1tzdb_ d.143.1.3 (B:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
glilkrssepehycmvrlmadvlrgcvpafhgvvlqlqdlldgfdgpcvldckmgvrtyl
eeeltkarerpklrkdmykkmlavdpeapteeehaprymqwregisssttlgfriegikk
adgscstdfkttrsreqvtrvfeefmqgdaevlkrylnrlqqirdtleisdffrrhevig
ssllfvhdhchragvwlidfgkttplpngqildhrrpweegnredgyllgldnligilan
la

SCOPe Domain Coordinates for d1tzdb_:

Click to download the PDB-style file with coordinates for d1tzdb_.
(The format of our PDB-style files is described here.)

Timeline for d1tzdb_: