PDB entry 1tzd

View 1tzd on RCSB PDB site
Description: crystal structure of the catalytic core of inositol 1,4,5-trisphosphate 3-kinase
Class: transferase
Keywords: INOSITOL KINASE, transferase
Deposited on 2004-07-09, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.26
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol-trisphosphate 3-kinase a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Itpka
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17105
      • engineered (32)
      • engineered (238)
    Domains in SCOPe 2.07: d1tzda_
  • Chain 'B':
    Compound: inositol-trisphosphate 3-kinase a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Itpka
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17105
      • engineered (32)
      • engineered (238)
    Domains in SCOPe 2.07: d1tzdb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzdA (A:)
    swvqlaghtgsfkaagtsglilkrssepehycmvrlmadvlrgcvpafhgvverdgesyl
    qlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeha
    qravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvtrvfeefmqgd
    aevlkrylnrlqqirdtleisdffrrhevigssllfvhdhchragvwlidfgkttplpng
    qildhrrpweegnredgyllgldnligilanlaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzdA (A:)
    glilkrssepehycmvrlmadvlrgcvpafhgvvlqlqdlldgfdgpcvldckmgvrtyl
    eeeltkarerpklrkdmykkmlavdpeapteeehaprymqwregisssttlgfriegikk
    adgscstdfkttrsreqvtrvfeefmqgdaevlkrylnrlqqirdtleisdffrrhevig
    ssllfvhdhchragvwlidfgkttplpngqildhrrpweegnredgyllgldnligilan
    lae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzdB (B:)
    swvqlaghtgsfkaagtsglilkrssepehycmvrlmadvlrgcvpafhgvverdgesyl
    qlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeha
    qravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvtrvfeefmqgd
    aevlkrylnrlqqirdtleisdffrrhevigssllfvhdhchragvwlidfgkttplpng
    qildhrrpweegnredgyllgldnligilanlaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzdB (B:)
    glilkrssepehycmvrlmadvlrgcvpafhgvvlqlqdlldgfdgpcvldckmgvrtyl
    eeeltkarerpklrkdmykkmlavdpeapteeehaprymqwregisssttlgfriegikk
    adgscstdfkttrsreqvtrvfeefmqgdaevlkrylnrlqqirdtleisdffrrhevig
    ssllfvhdhchragvwlidfgkttplpngqildhrrpweegnredgyllgldnligilan
    la