SCOPe 2.08: Domain d1tzab1: 1tza B:3-128

Lineage for d1tzab1 (1tza B:3-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.23: ApaG-like [110069] (2 families)

5. Family b.1.23.1: ApaG-like [110070] (1 protein)
   Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit

6. Protein ApaG [110071] (4 species)

7. Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry)
   Uniprot Q8EB92

8. Domain d1tzab1: 1tza B:3-128 [107469]
   Other proteins in same PDB: d1tzaa2, d1tzab2
   Structural genomics target
   complexed with cac

Details for d1tzab1

PDB Entry: 1tza, 2.4 Å

PDB Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45

PDB Compounds: (B:) apaG protein

SCOPe Domain Sequences for d1tzab1:

Sequence, based on SEQRES records:

>d1tzab1 b.1.23.1 (B:3-128) ApaG {Shewanella oneidensis [TaxId: 70863]}
aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
gllhle

Sequence, based on observed residues (ATOM records):

>d1tzab1 b.1.23.1 (B:3-128) ApaG {Shewanella oneidensis [TaxId: 70863]}
aldnsirvevkteyieqqssekylfsytitiinlgeqaakletrhwiitdangktsevqg
agvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgll
hle

Timeline for d1tzab1:

• d1tzab1 first appeared in SCOP 1.69, called d1tzab_
  
• d1tzab1 appears in SCOPe 2.07