![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.23: ApaG-like [110069] (2 families) ![]() |
![]() | Family b.1.23.1: ApaG-like [110070] (1 protein) Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit |
![]() | Protein ApaG [110071] (4 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry) Uniprot Q8EB92 |
![]() | Domain d1tzab1: 1tza B:3-128 [107469] Other proteins in same PDB: d1tzaa2, d1tzab2 Structural genomics target complexed with cac |
PDB Entry: 1tza (more details), 2.4 Å
SCOPe Domain Sequences for d1tzab1:
Sequence, based on SEQRES records: (download)
>d1tzab1 b.1.23.1 (B:3-128) ApaG {Shewanella oneidensis [TaxId: 70863]} aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp gllhle
>d1tzab1 b.1.23.1 (B:3-128) ApaG {Shewanella oneidensis [TaxId: 70863]} aldnsirvevkteyieqqssekylfsytitiinlgeqaakletrhwiitdangktsevqg agvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgll hle
Timeline for d1tzab1: