Lineage for d1tzaa1 (1tza A:3-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766701Superfamily b.1.23: ApaG-like [110069] (2 families) (S)
  5. 2766702Family b.1.23.1: ApaG-like [110070] (1 protein)
    Pfam PF04379; dimeric in crystals; this dimer is a probable biological unit
  6. 2766703Protein ApaG [110071] (4 species)
  7. 2766709Species Shewanella oneidensis [TaxId:70863] [110072] (1 PDB entry)
    Uniprot Q8EB92
  8. 2766710Domain d1tzaa1: 1tza A:3-128 [107468]
    Other proteins in same PDB: d1tzaa2, d1tzab2
    Structural genomics target
    complexed with cac

Details for d1tzaa1

PDB Entry: 1tza (more details), 2.4 Å

PDB Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45
PDB Compounds: (A:) apaG protein

SCOPe Domain Sequences for d1tzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzaa1 b.1.23.1 (A:3-128) ApaG {Shewanella oneidensis [TaxId: 70863]}
aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
gllhle

SCOPe Domain Coordinates for d1tzaa1:

Click to download the PDB-style file with coordinates for d1tzaa1.
(The format of our PDB-style files is described here.)

Timeline for d1tzaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tzaa2