PDB entry 1tza

View 1tza on RCSB PDB site
Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2004-07-09, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apaG protein
    Species: Shewanella oneidensis [TaxId:211586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EB92 (Start-125)
      • modified residue (95)
      • modified residue (101)
      • cloning artifact (126-127)
      • expression tag (128-133)
    Domains in SCOPe 2.07: d1tzaa1, d1tzaa2
  • Chain 'B':
    Compound: apaG protein
    Species: Shewanella oneidensis [TaxId:211586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EB92 (Start-125)
      • modified residue (95)
      • modified residue (101)
      • cloning artifact (126-127)
      • expression tag (128-133)
    Domains in SCOPe 2.07: d1tzab1, d1tzab2
  • Heterogens: CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzaA (A:)
    msaldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangkt
    sevqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrla
    tpgllhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzaA (A:)
    aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
    vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
    gllhlehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzaB (B:)
    msaldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangkt
    sevqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrla
    tpgllhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzaB (B:)
    aldnsirvevkteyieqqssekylfsytitiinlgeqaakletrhwiitdangktsevqg
    agvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgll
    hlehhhhhh