| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.284.1: PurS-like [82697] (3 families) ![]() segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
| Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein) automatically mapped to Pfam PF02700 |
| Protein PurS subunit of FGAM synthetase [82699] (3 species) |
| Species Bacillus subtilis [TaxId:1423] [111001] (2 PDB entries) Uniprot P12049 # YexA |
| Domain d1twja_: 1twj A: [107407] |
PDB Entry: 1twj (more details), 2.5 Å
SCOPe Domain Sequences for d1twja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twja_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]}
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee
Timeline for d1twja_: