SCOP 1.69: Domain d1twja_: 1twj A:

Lineage for d1twja_ (1twj A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (2 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.1: PurS subunit of FGAM synthetase [82698] (1 protein)

6. Protein PurS subunit of FGAM synthetase [82699] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [111001] (2 PDB entries)

8. Domain d1twja_: 1twj A: [107407]

Details for d1twja_

PDB Entry: 1twj, 2.5 Å

PDB Description: Crystal Structure of B. subtilis PurS P21 Crystal Form

SCOP Domain Sequences for d1twja_:

Sequence; same for both SEQRES and ATOM records:

>d1twja_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis}
mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
mcekllantviedyryevee

Timeline for d1twja_:

• d1twja_ is new in SCOP 1.69
  
• d1twja_ appears in SCOP 1.71
  
• d1twja_ appears in the current release, SCOPe 2.08