PDB entry 1twj

View 1twj on RCSB PDB site
Description: Crystal Structure of B. subtilis PurS P21 Crystal Form
Class: Formylglycinamide Synthetase
Keywords: PurS, Formylglycinamide synthetase, FGAM
Deposited on 2004-07-01, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0062 protein yexA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YEXA, BSU06460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twja_
  • Chain 'B':
    Compound: Hypothetical UPF0062 protein yexA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YEXA, BSU06460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twjb_
  • Chain 'C':
    Compound: Hypothetical UPF0062 protein yexA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YEXA, BSU06460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twjc_
  • Chain 'D':
    Compound: Hypothetical UPF0062 protein yexA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YEXA, BSU06460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1twjd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1twjA (A:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryeveevvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twjA (A:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryevee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1twjB (B:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryeveevvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twjB (B:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryevee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1twjC (C:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryeveevvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twjC (C:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryeve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1twjD (D:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryeveevvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1twjD (D:)
    mykvkvyvslkesvldpqgsavqhalhsmtynevqdvrigkymeltieksdrdldvlvke
    mcekllantviedyryevee