Lineage for d1tw9e2 (1tw9 E:1-77)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601276Protein Class sigma GST [81362] (5 species)
  7. 1601280Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry)
    Uniprot Q9NJQ6 # Fragment
  8. 1601285Domain d1tw9e2: 1tw9 E:1-77 [107390]
    Other proteins in same PDB: d1tw9a1, d1tw9b1, d1tw9c1, d1tw9d1, d1tw9e1, d1tw9f1, d1tw9g1, d1tw9h1

Details for d1tw9e2

PDB Entry: 1tw9 (more details), 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus
PDB Compounds: (E:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tw9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw9e2 c.47.1.5 (E:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}
mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
laqsqaicrylaktfgf

SCOPe Domain Coordinates for d1tw9e2:

Click to download the PDB-style file with coordinates for d1tw9e2.
(The format of our PDB-style files is described here.)

Timeline for d1tw9e2: