Lineage for d1tw9e2 (1tw9 E:1-77)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486990Protein Class sigma GST [81362] (5 species)
  7. 486994Species Heligmosomoides polygyrus [TaxId:6339] [110608] (1 PDB entry)
  8. 486999Domain d1tw9e2: 1tw9 E:1-77 [107390]
    Other proteins in same PDB: d1tw9a1, d1tw9b1, d1tw9c1, d1tw9d1, d1tw9e1, d1tw9f1, d1tw9g1, d1tw9h1

Details for d1tw9e2

PDB Entry: 1tw9 (more details), 1.71 Å

PDB Description: Glutathione Transferase-2, apo form, from the nematode Heligmosomoides polygyrus

SCOP Domain Sequences for d1tw9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw9e2 c.47.1.5 (E:1-77) Class sigma GST {Heligmosomoides polygyrus}
mvhykltyfngrgagecarqvfaladqkyedvrltqetfvplkatfpfgqvpvlevdgqq
laqsqaicrylaktfgf

SCOP Domain Coordinates for d1tw9e2:

Click to download the PDB-style file with coordinates for d1tw9e2.
(The format of our PDB-style files is described here.)

Timeline for d1tw9e2: