Lineage for d1tugc1 (1tug C:1-150,C:151-310)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. Domain d1tugc1: 1tug C:1-150,C:151-310 [107342]
    Other proteins in same PDB: d1tugb1, d1tugb2, d1tugd1, d1tugd2
    complexed with ctp, mli, pct, zn; mutant
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1tugc1

PDB Entry: 1tug (more details), 2.1 Å

PDB Description: Aspartate Transcarbamoylase Catalytic Chain Mutant E50A Complex with Phosphonoacetamide, Malonate, and Cytidine-5-Prime-Triphosphate (CTP)
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1tugc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tugc1 c.78.1.1 (C:1-150,C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffaastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqgXrldnlhvamvgdlkygrtvhsltqalakf
dgnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpse
yanvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqal
lalvlnrdlvl

SCOPe Domain Coordinates for d1tugc1 are not available.

Timeline for d1tugc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tuga1, d1tugb1, d1tugb2, d1tugd1, d1tugd2