PDB entry 1tug

View 1tug on RCSB PDB site
Description: Aspartate Transcarbamoylase Catalytic Chain Mutant E50A Complex with Phosphonoacetamide, Malonate, and Cytidine-5-Prime-Triphosphate (CTP)
Class: hydrolase/hydrolase regulator
Keywords: protein structure-function, site specific mutagenesis, domain closure, allosteric transition, HYDROLASE/HYDROLASE REGULATOR COMPLEX
Deposited on 2004-06-24, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB, B4245, C5345, Z5856, ECS5222, SF4245, S4507
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered (49)
    Domains in SCOPe 2.07: d1tuga1
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI, B4244, C5344, Z5855, ECS5221
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (1-152)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1tugb1, d1tugb2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRB, B4245, C5345, Z5856, ECS5222, SF4245, S4507
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered (49)
    Domains in SCOPe 2.07: d1tugc1
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:562]
    Gene: PYRI, B4244, C5344, Z5855, ECS5221
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (1-152)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1tugd1, d1tugd2
  • Heterogens: ZN, MLI, PCT, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tugA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffaastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tugB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tugC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffaastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tugD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan