Lineage for d1tugc1 (1tug C:1-150,C:151-310)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493143Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 493157Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)
  8. 493181Domain d1tugc1: 1tug C:1-150,C:151-310 [107342]
    Other proteins in same PDB: d1tugb1, d1tugb2, d1tugd1, d1tugd2

Details for d1tugc1

PDB Entry: 1tug (more details), 2.1 Å

PDB Description: Aspartate Transcarbamoylase Catalytic Chain Mutant E50A Complex with Phosphonoacetamide, Malonate, and Cytidine-5-Prime-Triphosphate (CTP)

SCOP Domain Sequences for d1tugc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tugc1 c.78.1.1 (C:1-150,C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffaastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqgXrldnlhvamvgdlkygrtvhsltqalakf
dgnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpse
yanvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqal
lalvlnrdlvl

SCOP Domain Coordinates for d1tugc1:

Click to download the PDB-style file with coordinates for d1tugc1.
(The format of our PDB-style files is described here.)

Timeline for d1tugc1: