SCOPe 2.07: Domain d1tqyb2: 1tqy B:247-403

Lineage for d1tqyb2 (1tqy B:247-403)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (10 proteins)

6. Protein Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB [110754] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [110755] (1 PDB entry)
   Uniprot Q02062

8. Domain d1tqyb2: 1tqy B:247-403 [107248]
   Other proteins in same PDB: d1tqya1, d1tqya2, d1tqyc1, d1tqyc2, d1tqye1, d1tqye2, d1tqyg1, d1tqyg2
   complexed with ace, mg, na

Details for d1tqyb2

PDB Entry: 1tqy, 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor

PDB Compounds: (B:) Actinorhodin polyketide putative beta-ketoacyl synthase 2

SCOPe Domain Sequences for d1tqyb2:

Sequence; same for both SEQRES and ATOM records:

>d1tqyb2 c.95.1.1 (B:247-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]}
rhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagvpelda
aearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvtsvpre
ygidlvlgeprstaprtalvlargrwgfnsaavlrrf

Timeline for d1tqyb2:

• d1tqyb2 first appeared in SCOP 1.69
  
• d1tqyb2 appears in SCOPe 2.06
  
• d1tqyb2 appears in the current release, SCOPe 2.08