Lineage for d1tqna_ (1tqn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005397Protein Mammalian cytochrome P450 3a4 [109958] (1 species)
  7. 2005398Species Human (Homo sapiens) [TaxId:9606] [109959] (7 PDB entries)
    Uniprot P08684
  8. 2005399Domain d1tqna_: 1tqn A: [107238]
    complexed with hem

Details for d1tqna_

PDB Entry: 1tqn (more details), 2.05 Å

PDB Description: Crystal Structure of Human Microsomal P450 3A4
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d1tqna_:

Sequence, based on SEQRES records: (download)

>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdv
qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgt

Sequence, based on observed residues (ATOM records): (download)

>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnsshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqkl
qeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkg
vvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmn
mklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgt

SCOPe Domain Coordinates for d1tqna_:

Click to download the PDB-style file with coordinates for d1tqna_.
(The format of our PDB-style files is described here.)

Timeline for d1tqna_: