PDB entry 1tqn

View 1tqn on RCSB PDB site
Description: Crystal Structure of Human Microsomal P450 3A4
Class: oxidoreductase
Keywords: P450, CYP3A4, monooxygenase, drug metabolizing enzyme, oxidoreductase, heme
Deposited on 2004-06-17, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqna_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqnA (A:)
    malygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpv
    laitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgk
    lkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqd
    pfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrl
    edtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyel
    athpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdv
    eingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprn
    cigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtvs
    gahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqnA (A:)
    hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
    dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
    iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
    kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
    rvdflqlmidsqnsshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqkl
    qeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkg
    vvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmn
    mklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgt