Lineage for d1tqia2 (1tqi A:91-282)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546213Family d.144.1.9: RIO1-like kinases [111204] (1 protein)
    Pfam PF01163
  6. 2546214Protein Rio2 serine protein kinase C-terminal domain [111205] (1 species)
  7. 2546215Species Archaeoglobus fulgidus [TaxId:2234] [111206] (5 PDB entries)
    Uniprot O30245 # AF2426
  8. 2546216Domain d1tqia2: 1tqi A:91-282 [107227]
    Other proteins in same PDB: d1tqia1
    complexed with edo

Details for d1tqia2

PDB Entry: 1tqi (more details), 2 Å

PDB Description: Crystal Structure of A. Fulgidus Rio2 Serine Protein Kinase
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1tqia2:

Sequence, based on SEQRES records: (download)

>d1tqia2 d.144.1.9 (A:91-282) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
vdaigklmgegkesavfncysekfgecvvkfhkvghtsfkkvkekrdygdlhfsvlairs
arnefralqklqglavpkvyawegnavlmelidakelyrvrvenpdevldmileevakfy
hrgivhgdlsqynvlvseegiwiidfpqsvevgeegwreilerdvrniityfsrtyrtek
dinsaidrilqe

Sequence, based on observed residues (ATOM records): (download)

>d1tqia2 d.144.1.9 (A:91-282) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
vdaigklmgegkesavfncysekfgecvvkfhkvkvkehfsvlairsarnefralqklqg
lavpkvyawegnavlmelidakelyrvrvenpdevldmileevakfyhrgivhgdlsqyn
vlvseegiwiidfpqsvevgeegwreilerdvrniityfsrtyrtekdinsaidrilqe

SCOPe Domain Coordinates for d1tqia2:

Click to download the PDB-style file with coordinates for d1tqia2.
(The format of our PDB-style files is described here.)

Timeline for d1tqia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tqia1