Lineage for d1tqia2 (1tqi A:91-282)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512536Family d.144.1.9: RIO1-like kinases (Pfam 01163) [111204] (1 protein)
  6. 512537Protein Rio2 serine protein kinase C-terminal domain [111205] (1 species)
  7. 512538Species Archaeoglobus fulgidus [TaxId:2234] [111206] (3 PDB entries)
  8. 512539Domain d1tqia2: 1tqi A:91-282 [107227]
    Other proteins in same PDB: d1tqia1

Details for d1tqia2

PDB Entry: 1tqi (more details), 2 Å

PDB Description: Crystal Structure of A. Fulgidus Rio2 Serine Protein Kinase

SCOP Domain Sequences for d1tqia2:

Sequence, based on SEQRES records: (download)

>d1tqia2 d.144.1.9 (A:91-282) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus}
vdaigklmgegkesavfncysekfgecvvkfhkvghtsfkkvkekrdygdlhfsvlairs
arnefralqklqglavpkvyawegnavlmelidakelyrvrvenpdevldmileevakfy
hrgivhgdlsqynvlvseegiwiidfpqsvevgeegwreilerdvrniityfsrtyrtek
dinsaidrilqe

Sequence, based on observed residues (ATOM records): (download)

>d1tqia2 d.144.1.9 (A:91-282) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus}
vdaigklmgegkesavfncysekfgecvvkfhkvkvkehfsvlairsarnefralqklqg
lavpkvyawegnavlmelidakelyrvrvenpdevldmileevakfyhrgivhgdlsqyn
vlvseegiwiidfpqsvevgeegwreilerdvrniityfsrtyrtekdinsaidrilqe

SCOP Domain Coordinates for d1tqia2:

Click to download the PDB-style file with coordinates for d1tqia2.
(The format of our PDB-style files is described here.)

Timeline for d1tqia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tqia1