PDB entry 1tqi

View 1tqi on RCSB PDB site
Description: Crystal Structure of A. Fulgidus Rio2 Serine Protein Kinase
Class: ribosome
Keywords: SERINE KINASE, ribosome
Deposited on 2004-06-17, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: RIO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tqia1, d1tqia2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tqiA (A:)
    mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
    qnrqkdyegstftfiglslyslhrlvrsgkvdaigklmgegkesavfncysekfgecvvk
    fhkvghtsfkkvkekrdygdlhfsvlairsarnefralqklqglavpkvyawegnavlme
    lidakelyrvrvenpdevldmileevakfyhrgivhgdlsqynvlvseegiwiidfpqsv
    evgeegwreilerdvrniityfsrtyrtekdinsaidrilqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqiA (A:)
    mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
    qnrqkdyegstftfiglslyslhrlvrsgkvdaigklmgegkesavfncysekfgecvvk
    fhkvkvkehfsvlairsarnefralqklqglavpkvyawegnavlmelidakelyrvrve
    npdevldmileevakfyhrgivhgdlsqynvlvseegiwiidfpqsvevgeegwreiler
    dvrniityfsrtyrtekdinsaidrilqe