SCOP 1.69: Domain d1tqbc2: 1tqb C:108-214

Lineage for d1tqbc2 (1tqb C:108-214)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1tqbc2: 1tqb C:108-214 [107216]
   Other proteins in same PDB: d1tqba_, d1tqbb1, d1tqbc1

Details for d1tqbc2

PDB Entry: 1tqb, 2.55 Å

PDB Description: Ovine recombinant PrP(114-234), VRQ variant in complex with the Fab of the VRQ14 antibody

SCOP Domain Sequences for d1tqbc2:

Sequence; same for both SEQRES and ATOM records:

>d1tqbc2 b.1.1.2 (C:108-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1tqbc2:

• d1tqbc2 is new in SCOP 1.69
  
• d1tqbc2 appears in SCOP 1.71
  
• d1tqbc2 appears in the current release, SCOPe 2.08