Lineage for d1tqba_ (1tqb A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498764Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 498765Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 498766Family d.6.1.1: Prion-like [54099] (2 protein domains)
  6. 498767Protein Prion protein domain [54100] (5 species)
  7. 498796Species Sheep (Ovis aries) [TaxId:9940] [102729] (4 PDB entries)
  8. 498799Domain d1tqba_: 1tqb A: [107212]
    Other proteins in same PDB: d1tqbb1, d1tqbb2, d1tqbc1, d1tqbc2

Details for d1tqba_

PDB Entry: 1tqb (more details), 2.55 Å

PDB Description: Ovine recombinant PrP(114-234), VRQ variant in complex with the Fab of the VRQ14 antibody

SCOP Domain Sequences for d1tqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqba_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries)}
glggymlgsvmsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
vkqhtvttttkgenftetdikimervveqmcitqyqresqay

SCOP Domain Coordinates for d1tqba_:

Click to download the PDB-style file with coordinates for d1tqba_.
(The format of our PDB-style files is described here.)

Timeline for d1tqba_: