SCOPe 2.08: Domain d1tkkh2: 1tkk H:2-125

Lineage for d1tkkh2 (1tkk H:2-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein L-Ala-D/L-Glu epimerase [69711] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
   Uniprot O34508

8. Domain d1tkkh2: 1tkk H:2-125 [107104]
   Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1
   complexed with ala, mg

Details for d1tkkh2

PDB Entry: 1tkk, 2.1 Å

PDB Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis

PDB Compounds: (H:) similar to chloromuconate cycloisomerase

SCOPe Domain Sequences for d1tkkh2:

Sequence; same for both SEQRES and ATOM records:

>d1tkkh2 d.54.1.1 (H:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds
iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq
mlgg

Timeline for d1tkkh2:

• d1tkkh2 first appeared in SCOP 1.69
  
• d1tkkh2 appears in SCOPe 2.07