![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein L-Ala-D/L-Glu epimerase [69711] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries) Uniprot O34508 |
![]() | Domain d1tkkb2: 1tkk B:2-125 [107092] Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1 complexed with ala, mg |
PDB Entry: 1tkk (more details), 2.1 Å
SCOPe Domain Sequences for d1tkkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkkb2 d.54.1.1 (B:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq mlgg
Timeline for d1tkkb2: