Lineage for d1tkkf2 (1tkk F:2-125)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
    Uniprot O34508
  8. Domain d1tkkf2: 1tkk F:2-125 [107100]
    Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1
    complexed with ala, mg

Details for d1tkkf2

PDB Entry: 1tkk (more details), 2.1 Å

PDB Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis
PDB Compounds: (F:) similar to chloromuconate cycloisomerase

SCOPe Domain Sequences for d1tkkf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkkf2 d.54.1.1 (F:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds
iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq
mlgg

SCOPe Domain Coordinates for d1tkkf2 are not available.

Timeline for d1tkkf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tkkf1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tkka1, d1tkka2, d1tkkb1, d1tkkb2, d1tkkc1, d1tkkc2, d1tkkd1, d1tkkd2, d1tkke1, d1tkke2, d1tkkg1, d1tkkg2, d1tkkh1, d1tkkh2