Lineage for d1tkdb_ (1tkd B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168058Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1168122Protein Thioredoxin [52835] (14 species)
  7. 1168138Species Escherichia coli [TaxId:562] [52836] (45 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 1168171Domain d1tkdb_: 1tkd B: [107088]
    Other proteins in same PDB: d1tkda1, d1tkda2
    protein/DNA complex; complexed with 1pe, d3t, mes, mg, so4

Details for d1tkdb_

PDB Entry: 1tkd (more details), 2.49 Å

PDB Description: T7 DNA polymerase ternary complex with 8 oxo guanosine and dCMP at the elongation site
PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1tkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkdb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOPe Domain Coordinates for d1tkdb_:

Click to download the PDB-style file with coordinates for d1tkdb_.
(The format of our PDB-style files is described here.)

Timeline for d1tkdb_: