![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins) |
![]() | Protein AI-2 receptor LsrB [110745] (1 species) |
![]() | Species Salmonella typhi [TaxId:601] [110746] (2 PDB entries) |
![]() | Domain d1tjya_: 1tjy A: [107062] complexed with pav |
PDB Entry: 1tjy (more details), 1.3 Å
SCOP Domain Sequences for d1tjya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 601]} gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll pervifnkdnidkydf
Timeline for d1tjya_: