![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein AI-2 receptor LsrB [110745] (1 species) |
![]() | Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries) Uniprot Q8Z2X8 27-340 |
![]() | Domain d1tjya1: 1tjy A:27-340 [107062] Other proteins in same PDB: d1tjya2 complexed with pav |
PDB Entry: 1tjy (more details), 1.3 Å
SCOPe Domain Sequences for d1tjya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjya1 c.93.1.1 (A:27-340) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe rvifnkdnidkydf
Timeline for d1tjya1: