SCOPe 2.08: Domain d1tjya1: 1tjy A:27-340

Lineage for d1tjya1 (1tjy A:27-340)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein AI-2 receptor LsrB [110745] (1 species)

7. Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries)
   Uniprot Q8Z2X8 27-340

8. Domain d1tjya1: 1tjy A:27-340 [107062]
   Other proteins in same PDB: d1tjya2
   complexed with pav

Details for d1tjya1

PDB Entry: 1tjy, 1.3 Å

PDB Description: crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf

PDB Compounds: (A:) sugar transport protein

SCOPe Domain Sequences for d1tjya1:

Sequence; same for both SEQRES and ATOM records:

>d1tjya1 c.93.1.1 (A:27-340) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]}
aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
rvifnkdnidkydf

Timeline for d1tjya1:

• d1tjya1 first appeared in SCOP 1.69, called d1tjya_
  
• d1tjya1 appears in SCOPe 2.07