Lineage for d1tjya_ (1tjy A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494585Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 494586Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 494587Family c.93.1.1: L-arabinose binding protein-like [53823] (14 proteins)
  6. 494588Protein AI-2 receptor LsrB [110745] (1 species)
  7. 494589Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries)
  8. 494590Domain d1tjya_: 1tjy A: [107062]

Details for d1tjya_

PDB Entry: 1tjy (more details), 1.3 Å

PDB Description: crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf

SCOP Domain Sequences for d1tjya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi}
gsaeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqg
ydaiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvema
ahqvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqta
egiikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefg
lwdvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivll
pervifnkdnidkydf

SCOP Domain Coordinates for d1tjya_:

Click to download the PDB-style file with coordinates for d1tjya_.
(The format of our PDB-style files is described here.)

Timeline for d1tjya_: