Lineage for d1tila_ (1til A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925014Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 1925015Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. 1925016Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
    Uniprot O32727
  8. 1925022Domain d1tila_: 1til A: [107004]
    Other proteins in same PDB: d1tilb_, d1tild_, d1tilf_
    complexed with atp, mg

Details for d1tila_

PDB Entry: 1til (more details), 2.7 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii
PDB Compounds: (A:) Anti-sigma F factor

SCOPe Domain Sequences for d1tila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tila_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkkhivks

SCOPe Domain Coordinates for d1tila_:

Click to download the PDB-style file with coordinates for d1tila_.
(The format of our PDB-style files is described here.)

Timeline for d1tila_: