SCOPe 2.05: Domain d1tilf_: 1til F:

Lineage for d1tilf_ (1til F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (2 families)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
   automatically mapped to Pfam PF01740

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)
   Uniprot O32726 # 90% sequence identity

8. Domain d1tilf_: 1til F: [107009]
   Other proteins in same PDB: d1tila_, d1tilc_, d1tile_
   complexed with atp, mg

Details for d1tilf_

PDB Entry: 1til, 2.7 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii

PDB Compounds: (F:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1tilf_:

Sequence; same for both SEQRES and ATOM records:

>d1tilf_ c.13.2.1 (F:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]}
hmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdas
glgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

Timeline for d1tilf_:

• d1tilf_ first appeared in SCOP 1.69
  
• d1tilf_ appears in SCOPe 2.04
  
• d1tilf_ is called d1tilf1 in SCOPe 2.06
  
• d1tilf_ appears in the current release, SCOPe 2.08, called d1tilf1