Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
Protein Anti-sigma factor spoIIab [75535] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries) Uniprot O32727 |
Domain d1tila_: 1til A: [107004] Other proteins in same PDB: d1tilb1, d1tilb2, d1tild1, d1tild2, d1tilf1, d1tilf2 complexed with atp, mg |
PDB Entry: 1til (more details), 2.7 Å
SCOPe Domain Sequences for d1tila_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tila_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev ivesevnkgttvylkkhivks
Timeline for d1tila_: