Lineage for d1tila_ (1til A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
    Uniprot O32727
  8. Domain d1tila_: 1til A: [107004]
    Other proteins in same PDB: d1tilb1, d1tilb2, d1tild1, d1tild2, d1tilf1, d1tilf2
    complexed with atp, mg

Details for d1tila_

PDB Entry: 1til (more details), 2.7 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA:Poised for phosphorylation complex with ATP, crystal form II
PDB Compounds: (A:) Anti-sigma F factor

SCOPe Domain Sequences for d1tila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tila_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkkhivks

SCOPe Domain Coordinates for d1tila_ are not available.

Timeline for d1tila_:

Domains from other chains:
(mouse over for more information)
d1tilb1, d1tilb2, d1tilc_, d1tild1, d1tild2, d1tile_, d1tilf1, d1tilf2