| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species) |
| Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries) Uniprot P80564 |
| Domain d1ti4j2: 1ti4 J:1-195 [106969] Other proteins in same PDB: d1ti4a1, d1ti4a2, d1ti4b1, d1ti4c1, d1ti4c2, d1ti4d1, d1ti4e1, d1ti4e2, d1ti4f1, d1ti4g1, d1ti4g2, d1ti4h1, d1ti4i1, d1ti4i2, d1ti4j1, d1ti4k1, d1ti4k2, d1ti4l1 complexed with 4mo, ca, mgd, pyg, sf4 complexed with 4mo, ca, mgd, pyg, sf4 |
PDB Entry: 1ti4 (more details), 2.2 Å
SCOPe Domain Sequences for d1ti4j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti4j2 d.58.1.5 (J:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe
Timeline for d1ti4j2: