Lineage for d1ti4l1 (1ti4 L:196-274)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
    Uniprot P80564
  8. Domain d1ti4l1: 1ti4 L:196-274 [106972]
    Other proteins in same PDB: d1ti4a1, d1ti4a2, d1ti4b2, d1ti4c1, d1ti4c2, d1ti4d2, d1ti4e1, d1ti4e2, d1ti4f2, d1ti4g1, d1ti4g2, d1ti4h2, d1ti4i1, d1ti4i2, d1ti4j2, d1ti4k1, d1ti4k2, d1ti4l2
    complexed with 4mo, ca, mgd, pyg, sf4
    complexed with 4mo, ca, mgd, pyg, sf4

Details for d1ti4l1

PDB Entry: 1ti4 (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (L:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1ti4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti4l1 b.3.5.1 (L:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOPe Domain Coordinates for d1ti4l1 are not available.

Timeline for d1ti4l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ti4l2