SCOPe 2.01: Domain d1tf5a2: 1tf5 A:571-780

Lineage for d1tf5a2 (1tf5 A:571-780)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
   multihelical; consists of 2 all-alpha subdomains

4. Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family)

5. Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)

6. Protein Helical scaffold and wing domains of SecA [81888] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [81889] (4 PDB entries)
   Uniprot P28366

8. Domain d1tf5a2: 1tf5 A:571-780 [106835]
   Other proteins in same PDB: d1tf5a1, d1tf5a3, d1tf5a4

Details for d1tf5a2

PDB Entry: 1tf5, 2.18 Å

PDB Description: Crystal structure of SecA in an open conformation from Bacillus Subtilis

PDB Compounds: (A:) Preprotein translocase secA subunit

SCOPe Domain Sequences for d1tf5a2:

Sequence; same for both SEQRES and ATOM records:

>d1tf5a2 a.172.1.1 (A:571-780) Helical scaffold and wing domains of SecA {Bacillus subtilis [TaxId: 1423]}
skmvsravessqkrvegnnfdsrkqllqyddvlrqqreviykqrfevidsenlreivenm
ikssleraiaaytpreelpeewkldglvdlinttyldegaleksdifgkepdemlelimd
riitkynekeeqfgkeqmrefekvivlravdskwmdhidamdqlrqgihlrayaqtnplr
eyqmegfamfehmiesiedevakfvmkaei

Timeline for d1tf5a2:

• d1tf5a2 first appeared in SCOP 1.69
  
• d1tf5a2 appears in SCOP 1.75
  
• d1tf5a2 appears in SCOPe 2.02
  
• d1tf5a2 appears in the current release, SCOPe 2.08