| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Enolase [54828] (8 species) |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries) Uniprot P09104 |
| Domain d1te6b2: 1te6 B:1-139 [106800] Other proteins in same PDB: d1te6a1, d1te6b1 complexed with cl, mg, po4, trs |
PDB Entry: 1te6 (more details), 1.8 Å
SCOP Domain Sequences for d1te6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1te6b2 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn
Timeline for d1te6b2: