Lineage for d1te6b2 (1te6 B:1-139)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860453Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 860454Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 860455Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 860500Protein Enolase [54828] (8 species)
  7. 860544Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries)
    Uniprot P09104
  8. 860548Domain d1te6b2: 1te6 B:1-139 [106800]
    Other proteins in same PDB: d1te6a1, d1te6b1
    complexed with cl, mg, po4, trs

Details for d1te6b2

PDB Entry: 1te6 (more details), 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom
PDB Compounds: (B:) Gamma enolase

SCOP Domain Sequences for d1te6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te6b2 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOP Domain Coordinates for d1te6b2:

Click to download the PDB-style file with coordinates for d1te6b2.
(The format of our PDB-style files is described here.)

Timeline for d1te6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1te6b1