SCOP 1.73: Domain d1te6b2: 1te6 B:1-139

Lineage for d1te6b2 (1te6 B:1-139)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (7 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries)

8. Domain d1te6b2: 1te6 B:1-139 [106800]
   Other proteins in same PDB: d1te6a1, d1te6b1
   complexed with cl, mg, po4, trs

Details for d1te6b2

PDB Entry: 1te6, 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom

PDB Compounds: (B:) Gamma enolase

SCOP Domain Sequences for d1te6b2:

Sequence; same for both SEQRES and ATOM records:

>d1te6b2 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d1te6b2:

• d1te6b2 first appeared in SCOP 1.69
  
• d1te6b2 appears in SCOP 1.71
  
• d1te6b2 appears in SCOP 1.75
  
• d1te6b2 appears in the current release, SCOPe 2.08